PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00084.1.g00580.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 424aa    MW: 45411.7 Da    PI: 4.9243
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00084.1.g00580.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.81e-27188242156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  Zjn_sc00084.1.g00580.1.sm.mkhc 188 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIDSLTRHNIASHLQKYRSH 242
                                     6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.924185244IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-27186245IPR009057Homeodomain-like
SuperFamilySSF466896.0E-19186245IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26188242IPR006447Myb domain, plants
PfamPF002495.7E-8191240IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MLTVSPARCT ELEERAAAGG HASIGDVGME TEATGAVSDL DFDFSVDDID FGDFFLRLED  60
DGDALPDLEV DPADIFTDFE EIAGGNGVVE DQEVPTVHHP SPEVAHVDPC SGAGLAEENS  120
TAIADAEEGK GECNQHADEL VAAANNGDFA GGGTAAVAEE KSTSSTSSQE AESRCHKSSC  180
KNSHGKKKAK VDWTPELHRR FVQAVEQLGI DKAVPSRILE IMGIDSLTRH NIASHLQKYR  240
SHRKHMLARE AEAASWTQRR QMYAAGAGAA AVKRPDSNAW TVPTIGFPPP PPPPASHPMQ  300
HFGRPLHVWG HPTPTVDLPR VPMWPRHLVP RTPAPPWAPP PPPPSDPAAF WHHNPYMRGH  360
GHMPGQVIAM PMLAASSESI DAAIGDVLTE PWLPLPLGLK PPSVDSVMDE LQRQGVANVP  420
PACG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-17185240257ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965431.11e-152PREDICTED: probable transcription factor GLK1
SwissprotQ5Z5I41e-142GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLK3XWU21e-152K3XWU2_SETIT; Uncharacterized protein
STRINGSi006400m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.15e-59GOLDEN2-like 2